<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17593
| Description |
Uncharacterized protein |
| Sequence | MDLDEFRSILSSSGLDVWGIIDAAITVASMEYSGELKHRRDGIVERLYAQQQCRSCDVNVNPQQQPNGVGRTITKEVNDDEGGGGGDSPLTPQSIPQDEEEDEEQDPYGGLFDDEQTKILRIKEQLEDPHQSEDSVIDLLQTLSDMDLTFKGLKETDIGRHVNRLRKHPSNEVRTLVKHLVRKWKELVDEWVGSSHTDLQHSSLTDGDSPLIQNIQRKGQNGQQQGPDFGYSPNPHNWSPGFEKMNTETDMRPKSVIPKRETPSRPVSQSYPPMNASASAPQNRPRKDQNIERDRLASATKRLQENYQEVQNAKKQRTIQVMDIHEIPKPKNGFIAKNKGNFQGRHHR |
| Length | 348 |
| Position | Unknown |
| Organism | Lactuca sativa (Garden lettuce) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> campanulids> Asterales> Asteraceae> Cichorioideae> Cichorieae>
Lactucinae> Lactuca.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -1.076 |
| Instability index | 57.89 |
| Isoelectric point | 5.72 |
| Molecular weight | 39499.26 |
| Publications | PubMed=28401891
|
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP17593
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 79.61| 23| 118| 86| 109| 1
---------------------------------------------------------------------------
86- 109 (39.47/24.13) GDSPLTpQSIPQDEEEDEEQDP.YG
207- 230 (40.14/19.93) GDSPLI.QNIQRKGQNGQQQGPdFG
---------------------------------------------------------------------------
|