<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17586
| Description |
Uncharacterized protein |
| Sequence | MEETSSTISTSQKSTQELAMEGQKHLEDTIESAFQILSSMNDELCNPNLWSTSSPPPNVNTTNGHHGPSNGVSNGDATSSDAAHHFEMGGGALDEARLRYKASVAALRSVLIAIPNSKKAKAYDIDPMLTDEMDAEKLEDRASALRKELEDKNKHLKILIDQLRDLITDISSWQSPIVV |
| Length | 179 |
| Position | Head |
| Organism | Lactuca sativa (Garden lettuce) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> campanulids> Asterales> Asteraceae> Cichorioideae> Cichorieae>
Lactucinae> Lactuca.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.565 |
| Instability index | 39.75 |
| Isoelectric point | 4.90 |
| Molecular weight | 19561.53 |
| Publications | PubMed=28401891
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP17586
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.98| 22| 37| 88| 111| 1
---------------------------------------------------------------------------
88- 111 (32.27/29.34) MGGGALDEARLRYKASvaALRSVL
128- 149 (36.72/26.35) MLTDEMDAEKLEDRAS..ALRKEL
---------------------------------------------------------------------------
|