<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17584
Description |
Uncharacterized protein |
Sequence | MISTHLNNTTTTHSQSLTYSADQCSPYRLLLAFPWFANQIRFAKAHDSISNANPPFWIPIHIVIPERPTESTVFNVIADAHRISTVIDSDMVMVLSFGEMMEYDAPSKLMESDSYFSKLVAEYWSICRT |
Length | 129 |
Position | Tail |
Organism | Lactuca sativa (Garden lettuce) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> campanulids> Asterales> Asteraceae> Cichorioideae> Cichorieae>
Lactucinae> Lactuca.
|
Aromaticity | 0.12 |
Grand average of hydropathy | -0.047 |
Instability index | 33.44 |
Isoelectric point | 5.36 |
Molecular weight | 14709.57 |
Publications | PubMed=28401891
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
membrane GO:0016020 IBA:GO_Central
plant-type vacuole GO:0000325 IBA:GO_Central
vacuolar membrane GO:0005774 IBA:GO_Central
|
GO - Biological Function | ATPase-coupled transmembrane transporter activity GO:0042626 IBA:GO_Central
|
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
transmembrane transport GO:0055085 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP17584
No repeats found
No repeats found
|