<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17583
| Description |
Uncharacterized protein |
| Sequence | MDIISQLQEQVNTIAAIAFNTFGTLQRDAPPVRLSPNYPEPPAPAAGASAATATAAPPTATNTVAANPTTEESPSNNIAEQPKLLSAELVKAAKQFDALVAALPLSEGGEEAQLTRIEQLQAENDLVGQELQKQLEAAEKELKQVQELFNEAADNCLNLKKPD |
| Length | 163 |
| Position | Middle |
| Organism | Lactuca sativa (Garden lettuce) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> campanulids> Asterales> Asteraceae> Cichorioideae> Cichorieae>
Lactucinae> Lactuca.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.363 |
| Instability index | 60.09 |
| Isoelectric point | 4.36 |
| Molecular weight | 17270.07 |
| Publications | PubMed=28401891
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP17583
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.48| 14| 29| 29| 42| 3
---------------------------------------------------------------------------
29- 42 (29.57/15.08) APP.....VRLSPNYPEPP
56- 74 (20.91/ 8.92) APPtatntVAANPTTEESP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.69| 13| 27| 111| 123| 4
---------------------------------------------------------------------------
111- 123 (20.08/13.23) EAQLTRIEQLQAE
139- 151 (20.61/13.75) EKELKQVQELFNE
---------------------------------------------------------------------------
|