Description | Uncharacterized protein |
Sequence | MDIISQLQEQVNTIAAIAFNTFGTLQRDAPPVRLSPNYPEPPAPAAGASAATATAAPPTATNTVAANPTTEESPSNNIAEQPKLLSAELVKAAKQFDALVAALPLSEGGEEAQLTRIEQLQAENDLVGQELQKQLEAAEKELKQVQELFNEAADNCLNLKKPD |
Length | 163 |
Position | Middle |
Organism | Lactuca sativa (Garden lettuce) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> campanulids> Asterales> Asteraceae> Cichorioideae> Cichorieae> Lactucinae> Lactuca. |
Aromaticity | 0.03 |
Grand average of hydropathy | -0.363 |
Instability index | 60.09 |
Isoelectric point | 4.36 |
Molecular weight | 17270.07 |
Publications | PubMed=28401891 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036 |
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central |
Binary Interactions |
Repeats | >MDP17583 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 50.48| 14| 29| 29| 42| 3 --------------------------------------------------------------------------- 29- 42 (29.57/15.08) APP.....VRLSPNYPEPP 56- 74 (20.91/ 8.92) APPtatntVAANPTTEESP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 40.69| 13| 27| 111| 123| 4 --------------------------------------------------------------------------- 111- 123 (20.08/13.23) EAQLTRIEQLQAE 139- 151 (20.61/13.75) EKELKQVQELFNE --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) LSPNY 2) NIAEQPKLLSAELVK | 34 77 | 38 91 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab