Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MDAQFQSTLSNLENKLNALISSLTTSPTAAGAPAAALNLLEADDSLTSDIEILRQHQQNYARILKLREESASLEEKVKDIVREVVRYEKDIQTACGGDAYDDSDDSSDDEDDMSGAPGKPVRGRTMREIDYKLLLDFARRISKYNHQAAADAAAGAPAKPRPQIQQAQEPADTEMTGMNSHGGAGTTTEEGVAPVASVTKDATSWLDESANMTRQVYMLPYPMEDRIRMGLMGQIQLAGGEGRPDFDADKEVERLIREAEGLGTIGAVPPAAEMGEATRHAEEAAKAAAQAGVAATSGRAAAAAAPAPKPKAMLDLDLYDPDEDDE |
Length | 326 |
Position | Middle |
Organism | Aspergillus taichungensis |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.559 |
Instability index | 44.05 |
Isoelectric point | 4.49 |
Molecular weight | 34819.14 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP17557 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 167.52| 52| 137| 96| 175| 1 --------------------------------------------------------------------------- 96- 151 (81.49/37.27) GGDAYDDSDDSSDDEDDMSGAPGkpvRGrTMREIDYKLLLDFARRISKYNHQAAAD 239- 290 (84.80/30.16) GGEGRPDFDADKEVERLIREAEG...LG.TIGAVPPAAEMGEATRHAEEAAKAAAQ 312- 325 ( 1.24/ 7.62) ...AMLDLDLYDPDEDD....................................... --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 41.98| 11| 146| 152| 163| 2 --------------------------------------------------------------------------- 152- 163 (19.65/11.76) AAAGAPAkPRPQ 301- 311 (22.33/ 9.43) AAAAAPA.PKPK --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) AKAAAQAGVAATSGRAAAAAAPAPKPKAMLDLDLYDPDEDDE 2) RGRTMREID | 285 122 | 326 130 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab