<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17556
| Description |
mediator of RNA polymerase II transcription subunit 19a isoform X1 |
| Sequence | MDPEGKKFGRGPRELTGAVDLISHYKLLPHHEFFCKRSLPLSISDTHYLHNVVGDTEIRKGEGMQLDQLIQNTSYSREPNARIQPFDLDILREAFQLRETAPVDLPLAEKGIPTVAGKSKGESKDKERKHKKHKDRDKDNDKEHKKHKHRHKDRSKDKDKEKKKDRSGHHDSNADQSKKHHEKKRKHDGDEDINDIHRHKKSKHKSSKIDDMGAIKVAG |
| Length | 219 |
| Position | Head |
| Organism | Juglans regia (English walnut) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fagales> Juglandaceae> Juglans.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.500 |
| Instability index | 38.97 |
| Isoelectric point | 9.53 |
| Molecular weight | 25347.19 |
| Publications | PubMed=27145194
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
transcription factor binding GO:0008134 IBA:GO_Central
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP17556
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 97.38| 15| 15| 125| 139| 1
---------------------------------------------------------------------------
125- 139 (30.34/12.41) DKE.RKH....K.KHKDRDKD
141- 157 (21.12/ 6.44) DKEhKKH....KhRHKDRSKD
159- 173 (25.07/ 9.00) DKE.KKK....D.RSGHHDSN
175- 192 (20.86/ 6.27) DQS.KKHhekkR.KH.DGDED
---------------------------------------------------------------------------
|