<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17555
| Description |
mediator of RNA polymerase II transcription subunit 19a isoform X2 |
| Sequence | MDPEGKKFGRGPRELTGAVDLISHYKLLPHHEFFCKRSLPLSISDTHYLHNVVGDTEIRKGEGMQLDQLIQNTSYSREPNARIQPFDLDILREAFQLRETAPVDLPLAEKGIPTVAGKSKGESKDKERKHKKHKDRDKDNDKEHKKHKHRHKDRSKDKDKEKKKDRSGHHDSNADQSKKHHEKKRKHDGDEDINDIHRHKKT |
| Length | 202 |
| Position | Head |
| Organism | Juglans regia (English walnut) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fagales> Juglandaceae> Juglans.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.578 |
| Instability index | 40.96 |
| Isoelectric point | 9.47 |
| Molecular weight | 23594.16 |
| Publications | PubMed=27145194
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP17555
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 98.10| 15| 15| 125| 139| 1
---------------------------------------------------------------------------
125- 139 (30.02/11.67) DKE.RKHK.K..HKDRDKD
141- 157 (20.85/ 6.04) DKEhKKHKhR..HKDRSKD
159- 175 (22.68/ 7.16) DKE.KKKD.RsgHHDSNAD
179- 192 (24.55/ 8.31) KHH.EKKR.K..H.DGDED
---------------------------------------------------------------------------
|