<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17539
Description |
mediator of RNA polymerase II transcription subunit 32 isoform X2 |
Sequence | MKPGSPKMDNMVDSLNNAYQEFVVAAANVLEAKEVSGAQKTAATDAALENFKQRWELFRVACDQAEEFVESVKQRIGSECLVDEATGSLAGKPGQAATTGLPPISAVRLEQMSKAVRWLVIELQHGSGTGASHSHPPAPFDARFSEDAAQ |
Length | 150 |
Position | Tail |
Organism | Juglans regia (English walnut) |
Kingdom | Viridiplantae |
Lineage | |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.319 |
Instability index | 52.74 |
Isoelectric point | 5.04 |
Molecular weight | 16043.80 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP17539
No repeats found
|