<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17537
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MATATYPPPPPYYRLYRDYLQNPKSAPEPPPPIEGTYICFGGNYTTDDVLPNLEEQGVRQLYPKGPNIDFKKELRSLNRELQLHILELADVLVERPSQYARRVEEISLIFKNIHHLLNSLRPHQARATLIHILELQIQCRKQAVEDIKRFPRPPPFLSNEGVLPHCLEK |
| Length | 169 |
| Position | Middle |
| Organism | Juglans regia (English walnut) |
| Kingdom | Viridiplantae |
| Lineage | |
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.561 |
| Instability index | 73.74 |
| Isoelectric point | 7.75 |
| Molecular weight | 19613.36 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP17537
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.61| 15| 44| 74| 88| 2
---------------------------------------------------------------------------
74- 88 (25.66/17.40) LRSLN.RELQLHILEL
120- 135 (22.95/14.88) LRPHQaRATLIHILEL
---------------------------------------------------------------------------
|