<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17531
| Description |
mediator of RNA polymerase II transcription subunit 15a isoform X9 |
| Sequence | MDTLKRHLPVSGQDGLQELRKIAIRFEEKIFTAATSQGDYLRKISLKMLTMETKSQNPPANSLPPNSTGNGNKPPDPGGHHPSDEDDGSEDDEFYYHSQDEVSEEADGPPPTSSPDNSTGNYGQ |
| Length | 124 |
| Position | Tail |
| Organism | Juglans regia (English walnut) |
| Kingdom | Viridiplantae |
| Lineage | |
| Aromaticity | 0.06 |
| Grand average of hydropathy | -1.186 |
| Instability index | 58.48 |
| Isoelectric point | 4.57 |
| Molecular weight | 13558.45 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP17531
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 77.23| 13| 49| 58| 70| 1
---------------------------------------------------------------------------
58- 70 (26.39/ 9.65) PPANSLPPNSTGN
75- 87 (24.02/ 8.29) PDPGGHHPSDEDD
109- 121 (26.82/ 9.89) PPPTSSPDNSTGN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.66| 15| 20| 19| 37| 2
---------------------------------------------------------------------------
19- 37 (20.23/27.76) LRKIAIrfeeKIFTAAT.SQ
41- 56 (22.43/16.90) LRKISL....KMLTMETkSQ
---------------------------------------------------------------------------
|