<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17526
| Description |
mediator of RNA polymerase II transcription subunit 15a isoform X3 |
| Sequence | MDTNNWRPTTGQGPVGGGIGGGREAGEPTMDAGDWRTGLPFDSRSRIVNKIMDTLKRHLPISGQEGLHELRKIATRFEEKIFTAATSQGDYLRKISIKMLTMEMKSQNPPANSLPSNSAGNGNRPPDLGGHHPSDEDDGSEDDEFYYHSQDEVSEEADGPPPTSSPDNSTGNYGQ |
| Length | 175 |
| Position | Tail |
| Organism | Juglans regia (English walnut) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fagales> Juglandaceae> Juglans.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -1.049 |
| Instability index | 51.49 |
| Isoelectric point | 4.80 |
| Molecular weight | 18986.39 |
| Publications | PubMed=27145194
|
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | chromatin DNA binding GO:0031490 IEA:InterPro
transcription coactivator activity GO:0003713 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP17526
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 36.28| 9| 26| 1| 11| 3
---------------------------------------------------------------------------
1- 11 (15.84/13.21) MDTNNWRptTG
30- 38 (20.44/ 9.83) MDAGDWR..TG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.76| 12| 49| 109| 120| 4
---------------------------------------------------------------------------
109- 120 (24.09/11.00) PPANSLPSNSAG
160- 171 (25.67/12.10) PPPTSSPDNSTG
---------------------------------------------------------------------------
|