<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17524
| Description |
mediator of RNA polymerase II transcription subunit 15a isoform X6 |
| Sequence | MDTNNWRPTTGQGPVGGGIGGGREAGEPTMDAGDWRTGLPFDSRSRIVNKIMDTLKRHLPISGQEGLHELRKIATRFEEKIFTAATSQGDYLRKISIKMLTMEMKSQNPPANSLPSNSAGNGNRPPDLAHDNTHLDKEFIRSRLC |
| Length | 145 |
| Position | Tail |
| Organism | Juglans regia (English walnut) |
| Kingdom | Viridiplantae |
| Lineage | |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.786 |
| Instability index | 42.38 |
| Isoelectric point | 9.25 |
| Molecular weight | 15985.85 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP17524
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 36.28| 9| 26| 1| 11| 2
---------------------------------------------------------------------------
1- 11 (15.84/14.39) MDTNNWRptTG
30- 38 (20.44/10.74) MDAGDWR..TG
---------------------------------------------------------------------------
|