<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17475
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MATATYPPPPPYYRLYRDYLQNPKSAPEPPPPIEGTYICFGGNYTTDDVIPNLEEQGVRQLYPKGPNIDFKKELRSLNRELQLHILELADVLVERPSQYARRVEEISLIFKNIHHLLNSLRPHQARATLIHILELQIQRRKQAVEDIKRRREEAQKLLKESLATLDGH |
| Length | 168 |
| Position | Middle |
| Organism | Juglans regia (English walnut) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fagales> Juglandaceae> Juglans.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.679 |
| Instability index | 77.98 |
| Isoelectric point | 8.63 |
| Molecular weight | 19583.20 |
| Publications | PubMed=27145194
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP17475
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.81| 10| 19| 7| 16| 1
---------------------------------------------------------------------------
7- 16 (24.59/10.79) P.PPPPYYRLY
27- 37 (19.22/ 7.19) PePPPPIEGTY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 102.77| 36| 45| 74| 112| 2
---------------------------------------------------------------------------
74- 112 (51.54/38.18) LRSLN.RELQLHILELaDVlvERPSQ....YARRVEEISLIFKN
120- 160 (51.22/28.74) LRPHQaRATLIHILEL.QI..QRRKQavedIKRRREEAQKLLKE
---------------------------------------------------------------------------
|