<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17455

Description Mediator of RNA polymerase II transcription subunit 14
SequenceMAAELGQQTLDFSALVTRAAEDSFLSLKELVDKEKSRSSSTSASAAGDPQSDTERKINLLKYIYKTQQRMLRLNVLAKWCQQVPLIQYCQQLSSTLSSHDTCFTQAADSLFFMHEGLQQARAPVYDVPSAVEVLLTGSYQRIPKCIENVGIQSTLNEDQQKPALKKLDMLVRTKLLEVSLPREISEVKVSDGTAQLRVDGEFKVLVTLGYRGHLSMWRILHMELLVGERSGLVKLEESRRHILGDDLERRMAAAENPFLTLYSVLHEFCVALVMDTVIRQVQALRQGRWKDAIRFELISDGSTGHGGSAGSTQLNPDGEADSSGLRTPGLKILYWLDFDKNVGTPDSTSCPFIKIEPGPDLHIKCLHSTFIIDPITGKEAELFLDQSCIDVDKLLLKAICCNRYTRLLEIQKELGKNVQICRTAGDVVLQLPLDELDIDYRKNDKKSDSREYEGQEVLRVRAYGSSFFTLGINIRNGSFLLQTSRNILEPSVLSDCEEALNQGSMTAAEVFISLRSRSIMHLFASIGRFLGLEVYEHGFAAVKVPKNMLNGSSMLLMGFPDCGSSYFLLMLLDKEFKPLFKLLETQPDPSGKAHSFNDLNHVVRIKKIDIGQMQMLEDEMNLSLLDWGKLLSFLPSSGGPNHSSEHGILPEIGPESSMQIAGCPPSSFSSFVDEVFELEKGSSAIPFSVHNLSSSYSTSPASHFVSAPMNLHTMKAKTPSPKWEGSMQISQINNISKVSSMTTHYNGSLYSLSNLKGPAQSHSLSSLSSGTGRGTTMKKLSASKSEQDLASLRSTHSVEVGSGSPMDEDQLRLLNDTSNDAYGSKSARLLSPQVTAPRMSVPGAKSNGIRNSPSRPLAGSLRIAGSSSCTTTPVFSAHAPESAICPSPSQDVVSKHDKNPRKRTVSDVLNLIPSLQGLEAASRFCKRRKISEYAHALHPSSQAPISTEVVTKMEGYSYGNLIGEANKGNASSSIYVSALLHVVRHCSLSIKHARLTSQMEALDIPYVEEVGLRNASSNIWFRLPFARGDSWQHICLRLGRPGSMYWDVKINDQHFRDLWELQKGSNSTLWGSGVRIANTSDIDSHIRYDPDGVVLSYQSVDADSIKKLVADIRRLSNARMFALGMRKLLGIRGDEKPEECSTNSDVKAPIGAKGAPETADKLSEQMRRAFRIEAVGLMSLWFSFGSGVLARFVVEWESGKEGCTMHVSPDQLWPHTKFLEDFINGAEVASLLDCIRLTAGPLHALAAATRPARAGPGPGVPGVAAALSSIPKQAGYIATSQGLLPSNSTTSIGQATSVPVGNPAAPSGTGTLANHGLHGAAMLTAAGRSGPGIVPSSLLPIDVSVVLRSPYWIRIIYRKNFAVDMRCFAGDQVWLQPATPPKGGSSVGGSLPCPQFRPFIMEHVAQELNGLDPNFTGGQQMGGLANSNTHNPISGSQLSAANGNRINLPSSAVMARVGTQVSGLNRVGNTLSGSPNLAVVGSGMALRRTPGTSVPAHVRGELNTAIIGLGDDGGYGGGWVPLVALKKVLRGILKYLGVLWLFAQLPNLLKEILGSILKDNEGALLNLDQEQPALRFFVGGYVFAVSVHRVQLLLQVLSVKRFHHQQQQQQQNSPAAQEELTQSEISEICDYFSRRVASEPYDASRVASFITLLTLPISILREFLKLIAWKKGLAQAQGGDIAPAQKPRIELCLENHTGLNMDDNSENSSVAKSNIHYDRPHNSVDFALTVVLDPALIPHINAAGGAAWLPYCVSVRLRYAFGENPSVSFLDMEGSHGGRACWFRADDWEKCKQRVARTVELNGSSAADVNQGRLRIVADTVQRALHSYLQGLRDGGGITASSGSM
Length1845
PositionTail
OrganismJuglans regia (English walnut)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fagales> Juglandaceae> Juglans.
Aromaticity0.07
Grand average of hydropathy-0.186
Instability index43.12
Isoelectric point7.97
Molecular weight200700.31
Publications
PubMed=27145194

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
GO - Cellular Component
core mediator complex	GO:0070847	IBA:GO_Central
mediator complex	GO:0016592	IBA:GO_Central

GO - Biological Function
transcription coregulator activity	GO:0003712	IBA:GO_Central

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IBA:GO_Central









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP17455
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      88.79|      26|      47|     570|     595|       1
---------------------------------------------------------------------------
  570-  595 (47.36/28.59)	MLLDKEFKPLF...KLLETQPDPSGKAHS
  615-  643 (41.42/24.02)	MLEDEMNLSLLdwgKLLSFLPSSGGPNHS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      50.49|      16|      19|    1240|    1255|       2
---------------------------------------------------------------------------
 1240- 1255 (29.59/19.05)	GP.LHALAAA..TRPARAG
 1257- 1275 (20.90/10.87)	GPgVPGVAAAlsSIPKQAG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      50.00|      15|      19|     860|     878|       3
---------------------------------------------------------------------------
  864-  878 (27.19/20.15)	AGSSSC..TTTPVFSAH
  880-  896 (22.81/ 6.46)	PESAICpsPSQDVVSKH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      47.69|      14|      19|    1414|    1432|       4
---------------------------------------------------------------------------
 1417- 1431 (23.16/13.05)	GGQQMGGlANSNTHN
 1434- 1447 (24.54/ 8.21)	SGSQLSA.ANGNRIN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      62.46|      19|      19|     786|     804|       5
---------------------------------------------------------------------------
  786-  804 (31.81/15.59)	EQDLASLRSTHSVEVGSGS
  808-  826 (30.64/14.75)	EDQLRLLNDTSNDAYGSKS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      53.72|      18|      19|    1515|    1533|       6
---------------------------------------------------------------------------
 1515- 1533 (30.08/21.75)	Y.GGGWV....PLVaLKKVLRGIL
 1535- 1557 (23.65/11.69)	YlGVLWLfaqlPNL.LKEILGSIL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     147.00|      45|      47|     930|     975|       8
---------------------------------------------------------------------------
  930-  975 (71.31/48.75)	ISEYAHALHPSSQAPISTEVVTKMEGYSYGnLIGEANKGNASSSIY
  976- 1020 (75.68/47.32)	VSALLHVVRHCSLSIKHARLTSQMEALDIP.YVEEVGLRNASSNIW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      85.26|      20|      20|    1451|    1470|       9
---------------------------------------------------------------------------
 1451- 1470 (32.89/20.18)	SAVMARVGTQVSGLNRVGNT
 1474- 1492 (30.18/17.84)	SPNLAVVGSGMA.LRRTPGT
 1496- 1513 (22.20/10.95)	AHVRGELNTAIIGLGDDG..
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      52.27|      17|      18|    1096|    1113|      10
---------------------------------------------------------------------------
 1096- 1113 (23.03/20.78)	SYQSVDADSIKKLVAdIR
 1116- 1132 (29.25/20.59)	SNARMFALGMRKLLG.IR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      61.64|      21|      51|     690|     714|      13
---------------------------------------------------------------------------
  690-  714 (33.45/29.89)	HNLS...........SSYSTSPashfVSAPMNLHTM
  733-  764 (28.19/14.67)	NNISkvssmtthyngSLYSLSN....LKGPAQSHSL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      56.31|      18|     380|     649|     682|      15
---------------------------------------------------------------------------
  662-  682 (25.66/40.43)	GCPpsSFSS.........FVDeVFELEKGS
 1039- 1065 (30.65/ 7.92)	GRP..GSMYwdvkindqhFRD.LWELQKGS
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP17455 with Med14 domain of Kingdom Viridiplantae
Unable to open file!