<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17452
| Description |
mediator of RNA polymerase II transcription subunit 30-like isoform X1 |
| Sequence | MEEKTATAITNPKSTQELAMDGQKLLEETIESAFHILSSMNDELCNPALWSTISSASSSSLSSTSSTANITSIPNGPSQSSNGIANGDAASSDTHHAESGGGSGGALEEARFRYKSSVNSLRAVLAAIPNSEKAKSFELGSTPSGPLSPAGQDEIEKLEERASGLRKELASKNRYLKVLIDQLRDLITDVSTWQSPCSI |
| Length | 199 |
| Position | Head |
| Organism | Juglans regia (English walnut) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fagales> Juglandaceae> Juglans.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.439 |
| Instability index | 52.23 |
| Isoelectric point | 4.92 |
| Molecular weight | 20960.86 |
| Publications | PubMed=27145194
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP17452
No repeats found
No repeats found
|