<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17449
Description |
cyclin-C1-2-like isoform X1 |
Sequence | MAANFWTSSHQKQLLDQEEVDVVHPLDKDKGITLEDFKLIKMHMANYILKLAQHVKVRQRVVATAVAYMRRVYTRKSMNEYDPRLVAPTCLYLASKAEESTVQARLLVFVLKKLYSDEKYRYDRHEIKDILEMEMKILEALNYYLVVFHPYRALSQLLQDAGLNDISMTQLTWGLVNDTYKTDLVLIHAPHLIALACIYVASVLREKDTTAWFEELRIDMNAVKNISMEILDFYENHRMITDERIIAALSKLNLKP |
Length | 256 |
Position | Kinase |
Organism | Juglans regia (English walnut) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fagales> Juglandaceae> Juglans.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.131 |
Instability index | 31.57 |
Isoelectric point | 6.76 |
Molecular weight | 29925.55 |
Publications | PubMed=27145194
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
nucleus GO:0005634 IBA:GO_Central
|
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IBA:GO_Central
|
GO - Biological Process | cell cycle GO:0007049 IEA:UniProtKB-KW
cell division GO:0051301 IEA:UniProtKB-KW
positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP17449
No repeats found
|