<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17448
Description |
cyclin-C1-2-like isoform X3 |
Sequence | MRRVYTRKSMNEYDPRLVAPTCLYLASKAEESTVQARLLVFVLKKLYSDEKYRYDRHEIKDILEMEMKILEALNYYLVVFHPYRALSQLLQDAGLNDISMTQLTWGLVNDTYKTDLVLIHAPHLIALACIYVASVLREKDTTAWFEELRIDMNAVKNISMEILDFYENHRMITDERIIAALSKLNLKP |
Length | 188 |
Position | Kinase |
Organism | Juglans regia (English walnut) |
Kingdom | Viridiplantae |
Lineage | |
Aromaticity | 0.10 |
Grand average of hydropathy | -0.108 |
Instability index | 30.80 |
Isoelectric point | 6.22 |
Molecular weight | 22081.50 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP17448
No repeats found
No repeats found
|