<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17439
| Description |
mediator of RNA polymerase II transcription subunit 36a-like isoform X2 |
| Sequence | MRPPRGRGGGFRGRGDGGRGRGRGGGGRGGDRGSSMGGRGGRGFGGRGRGGGRGGMKGGSKVMVEPHRHGGVFIAKGKEDAIVTKNLVPGEAVYNEKRISVQNEDGTKVEYRVWNPFRSKLAAAIIGGVDEIWIKPGARVLYLGAASGTTVSHVSDIVGPTGVVYAVEFSHRSGRDLVNMAKKRTNVIPIIEDARHPSKYRMLVGMVDVIFSDVAQPDQARILALNASYFLKAGGHFVISIKANCIDSTQPAEAVFQSEVNKLKQDQFKPFEQVTLEPYERDHACVVGGYRVPKKSKIAA |
| Length | 300 |
| Position | Unknown |
| Organism | Juglans regia (English walnut) |
| Kingdom | Viridiplantae |
| Lineage | |
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.410 |
| Instability index | 26.14 |
| Isoelectric point | 10.17 |
| Molecular weight | 32085.25 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP17439
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 80.70| 17| 18| 5| 22| 1
---------------------------------------------------------------------------
5- 19 (21.81/ 8.05) ......RGRGGGfRGRGDGGR
20- 39 (31.89/ 9.74) GRGrggGGRGGD.RGSSMGGR
41- 59 (27.00/ 7.25) GRGfggRGRGGG.RGGMKGG.
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.44| 14| 18| 190| 203| 2
---------------------------------------------------------------------------
190- 203 (25.44/18.77) IIEDARHPSKYRML
210- 223 (24.00/17.33) IFSDVAQPDQARIL
---------------------------------------------------------------------------
|