<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17432

Description mediator of RNA polymerase II transcription subunit 16 isoform X3
SequenceMSQDSGPKEAEDEPAASESIEVSKGAEDTEPAASAEEDAVEKPDDPMDEDSVSPATVFCIRLKQPRSNLQHKMSVPELCRNFSAVAWCGKLNAIACASETCARIPSSNANPPFWIPIHIVIPERPTECAVFNVTADSPRDSVQFIEWSPTSCPRALLIANFHGRITIWTQPSQGSASLVRDASCWQPEHEWRQDIAVVTKWLSGVSQYRWLSSKAGTAVNSKSAFEEKFLSQQSQTSARWPNFLCVCSVFSSGSIQLHWSQWPPSQNGVALKWFSTSKGLLGAGPSGIMAADAIITDSGAMHVAGVPIVNPSTVVVWEVTPGPGNAFQATPKTSSSNGVPPSLNPPSWAGFAPLAAYLFSWQEYLISEAKQGKRTDQDLNDTVPLHCSPVSNFSAYVSPEAAAQSAATTTWGSGVTAVAFDPTRGGSVIAVVIVEGQYMSPYDPDEGPSITGWRVQRWESSLKPVVLHQIFGNPTSSYGGQAPMQTVWVSKVDTSIPPTNDFKSHEAAATGPTSDVRKTSDLTVDKGQKVIFDPFDLPSDVRTLARIVYSAHGGEIAIAFLRGGVHIFSGPNFAPVDNYQINVGSAIAAPAFSSTSCCSASVWHDTSKDRTMLKIIRVLPPAVPSSQAKANSSTWERAIAERFWWSLLVGVDWWDAVGCTQSAAEDSIVSLNSVIAVLDADFHSLPSTQHRQQYGPSLDRIKCRLLEGTNAQEVRAMVLDMQARLLLDMLGKGIESALLNPSALVPEPWHESGETLSGIDPEAMAVEPALVLSIQAYVDAVLDLASHFITRLRRYASFCRTLASHAVTAGTGSNRNMVASPTQSSATPATSQGGQSGTASSTGSTQMQAWVQGAIAKISSTNDGVSNSTPNPISGPSSFMPISINTGTFPGTPAVRLIGDCHFLHRLCQLLLFCFFFRRTQLPRFLLGAQRNAETNMQKPQPSAPSKLEEINSISAKPASAVARSEDGQISRVNQLLPGAKGVEEGPAGRSRLGSGNAGQGYTFEEVKDDALVSIQTPQK
Length1020
PositionTail
OrganismJuglans regia (English walnut)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fagales> Juglandaceae> Juglans.
Aromaticity0.08
Grand average of hydropathy-0.183
Instability index44.54
Isoelectric point5.59
Molecular weight109300.54
Publications
PubMed=27145194

Function

Annotated function 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
GO - Biological Process
regulation of transcription, DNA-templated	GO:0006355	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP17432
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      35.25|      10|      19|       8|      17|       1
---------------------------------------------------------------------------
    8-   17 (19.65/11.28)	KEAED.EPAAS
   24-   34 (15.60/ 7.42)	KGAEDtEPAAS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      58.78|      17|      19|     774|     790|       2
---------------------------------------------------------------------------
  774-  790 (28.66/21.15)	IQAYVDAVLDLASHFIT
  792-  808 (30.12/22.62)	LRRYASFCRTLASHAVT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.03|      16|      19|     185|     200|       3
---------------------------------------------------------------------------
  185-  200 (31.33/19.38)	WQ...PEHEW...RQDIAVVTK
  201-  222 (19.70/ 9.46)	WLsgvSQYRWlssKAGTAVNSK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      55.31|      15|      19|     819|     833|       4
---------------------------------------------------------------------------
  819-  833 (26.89/14.62)	ASPTQSSATPATSQG
  839-  853 (28.41/15.91)	ASSTGSTQMQAWVQG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      36.68|      11|     137|     414|     426|       5
---------------------------------------------------------------------------
  414-  426 (16.41/15.05)	GVTAVAFdpTRGG
  554-  564 (20.27/10.63)	GEIAIAF..LRGG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     102.32|      29|     183|     384|     413|       6
---------------------------------------------------------------------------
  384-  413 (48.99/33.91)	PlHCSPVSNFSAYVSPEAAAQSAATTTWGS
  571-  599 (53.33/32.69)	P.NFAPVDNYQINVGSAIAAPAFSSTSCCS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     116.71|      33|     183|     117|     163|       7
---------------------------------------------------------------------------
   57-   89 (61.89/49.64)	VFCIRLKQPRSNLQHKMSVPELC.RNFSAVAWCG
  130-  163 (54.82/33.64)	VFNVTADSPRDSVQFIEWSPTSCpRALLIANFHG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      54.77|      17|      18|     688|     705|       8
---------------------------------------------------------------------------
  688-  705 (27.05/27.10)	TQHRQQYGPSLDrIKCRL
  709-  725 (27.72/21.14)	TNAQEVRAMVLD.MQARL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      74.86|      21|      22|     860|     880|       9
---------------------------------------------------------------------------
  860-  880 (39.06/22.83)	STNDGVSNSTPN.PISGPSSFM
  883-  904 (35.80/20.24)	SINTGTFPGTPAvRLIGDCHFL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      41.89|      10|     246|     104|     114|      10
---------------------------------------------------------------------------
  104-  114 (18.63/11.32)	IPSSnANPPFW
  339-  348 (23.26/10.05)	VPPS.LNPPSW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      36.94|      10|      18|     739|     748|      11
---------------------------------------------------------------------------
  739-  748 (18.47/ 9.20)	LNPSALVPEP
  759-  768 (18.47/ 9.21)	IDPEAMAVEP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      52.96|      16|      19|     966|     982|      14
---------------------------------------------------------------------------
  966-  982 (24.17/18.30)	EDGQISRvNQLLPGAKG
  984-  999 (28.79/17.20)	EEGPAGR.SRLGSGNAG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      46.44|      13|      19|     229|     241|      15
---------------------------------------------------------------------------
  229-  241 (25.03/13.26)	FLSQQSQTS.ARWP
  250-  263 (21.41/10.25)	FSSGSIQLHwSQWP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      48.30|      17|      22|     499|     517|      16
---------------------------------------------------------------------------
  499-  517 (22.02/22.07)	TNDfKSHEaAATGP...TSDVR
  523-  542 (26.29/14.82)	TVD.KGQK.VIFDPfdlPSDVR
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP17432 with Med16 domain of Kingdom Viridiplantae
Unable to open file!