<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17430
| Description |
mediator of RNA polymerase II transcription subunit 36a-like isoform X2 |
| Sequence | MRPPRGRGGGFRGRGDGGRGRGRGGGGRGGDRGGAMRGRGGRGAGGRGRGGGRGGMKGGSKVVVEPHRHGGVFIAKGKEDAIVTKNLVPGEAVYNEKRISVQNEDGTKVEYRVWNPFRSKLAAAIIGGVDEIWIKPGARVLYLGAASGTTVSHVSDIVGPTGVVYAVEFSHRSGRDLVNMAKKRTNIIPIIEDARHPSKYRMLVGMVDVIFSDVAQPDQARILALNASYFLKAGGHFVISIKANCIDSTQPAEAVFQSEVNKLKQDQFKPFEQVTLEPYERDHACVVGGYRVPKKSKIAA |
| Length | 300 |
| Position | Unknown |
| Organism | Juglans regia (English walnut) |
| Kingdom | Viridiplantae |
| Lineage | |
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.408 |
| Instability index | 25.86 |
| Isoelectric point | 10.23 |
| Molecular weight | 32044.22 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP17430
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.12| 17| 18| 19| 36| 1
---------------------------------------------------------------------------
14- 30 (38.72/10.41) RGDGGRGR.GRGGG..GRGG
32- 51 (29.40/ 8.73) RGGAMRGRgGRGAGgrGRGG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.44| 14| 17| 190| 203| 2
---------------------------------------------------------------------------
190- 203 (25.44/19.88) IIEDARHPSKYRML
210- 223 (24.00/18.36) IFSDVAQPDQARIL
---------------------------------------------------------------------------
|