<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17382

Description mediator of RNA polymerase II transcription subunit 28
SequenceMASSMSGMFPGQQPPGSHPVGGPGGPGQPGFPGTAPRPQGNNTLVDELEASFEACFSSLVSQDYVNGTDQEEIRTGVDQCIQKFLDVARQTECFFLQKRLQLSVQKPEQVVKEDVSELRNELQRKEMLVQKHLTKLHHWQQVLEDLSGQHRKPTDLPPPGPLAFLEQASASLPPAPLKPS
Length180
PositionHead
OrganismAustrofundulus limnaeus
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata> Ovalentaria> Atherinomorphae> Cyprinodontiformes> Rivulidae> Austrofundulus.
Aromaticity0.06
Grand average of hydropathy-0.598
Instability index55.65
Isoelectric point5.51
Molecular weight19732.06
Publications









Function






Annotated function


GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-SubCell

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP17382
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      48.52|      15|      15|     105|     119|       1
---------------------------------------------------------------------------
  105-  119 (23.68/17.76)	QKPEQVVKEDVSELR
  123-  137 (24.84/18.96)	QRKEMLVQKHLTKLH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.80|      15|      22|      41|      62|       3
---------------------------------------------------------------------------
   41-   55 (25.01/30.37)	NNTLVDELEASFEAC
   66-   80 (26.79/13.33)	NGTDQEEIRTGVDQC
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP17382 with Med28 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MASSMSGMFPGQQPPGSHPVGGPGGPGQPGFPGTAPRPQGNNTL
1
44










Molecular Recognition Features






MoRF SequenceStartStop




NANANA