<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17372
| Description |
cyclin-dependent kinase 19-like |
| Sequence | MDYDFKTKLAAERERVEDLFEYEGCKVGRGTYGHVYKAKRKDGKDEKEYALKQIEGTGISMSACREIALLRELKHPNVIALQKVFLSHSDRKVWLLFDYAEHDLWHIIKFHRASKANKKPMQLPRGMVKSLLYQILDGIHYLHANWVLHRDLVSCYISFTAPVSLY |
| Length | 166 |
| Position | Kinase |
| Organism | Austrofundulus limnaeus |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Ovalentaria> Atherinomorphae> Cyprinodontiformes> Rivulidae>
Austrofundulus.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.395 |
| Instability index | 34.23 |
| Isoelectric point | 9.14 |
| Molecular weight | 19429.32 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | ATP binding GO:0005524 IEA:UniProtKB-UniRule
protein kinase activity GO:0004672 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP17372
No repeats found
No repeats found
|