Description | Mediator of RNA polymerase II transcription subunit 9 |
Sequence | MAVAQPKLEKENEDCSLLPLVHDIIKCMDKESQDVHQELAKLKAKIQEAREQISNMPGIDSSPQEQQQQLATLREQVHTKNQLLQKYKSLCMFDVPKAS |
Length | 99 |
Position | Middle |
Organism | Austrofundulus limnaeus |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata> Ovalentaria> Atherinomorphae> Cyprinodontiformes> Rivulidae> Austrofundulus. |
Aromaticity | 0.02 |
Grand average of hydropathy | -0.716 |
Instability index | 61.77 |
Isoelectric point | 5.88 |
Molecular weight | 11314.90 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364145 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP17365 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 32.87| 10| 15| 47| 56| 1 --------------------------------------------------------------------------- 47- 56 (16.73/ 9.90) QEAREQISNM 64- 73 (16.14/ 9.34) QEQQQQLATL --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) AVAQPKLEKENEDCSLLPLVHDIIKCMDK 2) QDVHQELAKLKAKIQEAREQISNMPGIDSSPQEQQQQLATLREQVHTKNQLLQKYKSLCMFDVPKA | 2 33 | 30 98 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab