<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17364

Description mediator of RNA polymerase II transcription subunit 24 isoform X3
SequenceMKVVNLKQAILQAWKERWSDYQWAINIKKNFPKGATWDYLNFAEALMEQAMIGPSPNPLILSYLKYAICSQMVSYSSVLTAISKFDGFSRELCVTSLLEIMDMFCHRLNCHGKAEECIGLCRALLGVVVWLLHGCAFYCDKLRELGPSASTESILQACQERLHNLMSSTKIRALVHIARLEDQGSWNNIEQAVLKVTESLCNVSNQTLRTKLEESVSLVKSIPLMLSVQCDLPVRASFPSVHAFIMLEGTMNLTGEVQPMVEQLMMIKRMQHIPCPLFVLEIWKACFTGLIESPEGTEELKWTAFTFLKIPQVLLGLKTYPQGDKGQDFMEDVNIAFQYLLKLTPLLDKADQRCNCDCLGMLLQECNKLGLLSDLNTENLTSKRTVDREFAPRLKTAENANIQPNPGLILRAEPTVTNILKTVDADHSKSPEGLLGVLGHMLSGKSLDLLLAAAAATGKLKSFARKFIKLNEFPKHISGEGSKSASVRALLFDISFLMLCHVVQTYGSEVVLSDLSPSGETPFFETWLQTCMPEEGKTLNPDHPCFRPEPGKVESLVTLLNNSSEMKLVQVKWHEICLSTPAAILEVLNAWENGVLSVEAVQKITDNIKGKVCSMAICAVAWLVAHVRMLGRDEREKPQTMIRQLVTPHYAENTLQFYTERVVIMSSIMEHMCADVFQQTGAVLRPPVEGQEPIPYRNLLPAKEPIHKALSQQFQTVLRKAWVDSRAFHVFESLLNMGGVFWFTNNLIRELLKETRQEWAIRVVELLYSIFCLDTQQITLTLLGTILPNLLTDSAHWHSLSDPPGKALAKLSVWCALSSYSSHHKGPSSARQRKRQREDIEDYNSLFPLDDTQPSKLMRLLSSNEDEPAALSSPGDRSMNSSLSASQIHTVNMRDPLNRVLANLFLLFSSILSSRMAGPHTQFVQSFIEECVECLEQGSHGSILQFMPFTMVSELVKLPALAKPKAVLAMTDLNLPLGRRVAAKAIASL
Length989
PositionTail
OrganismAustrofundulus limnaeus
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata> Ovalentaria> Atherinomorphae> Cyprinodontiformes> Rivulidae> Austrofundulus.
Aromaticity0.07
Grand average of hydropathy-0.009
Instability index47.31
Isoelectric point6.60
Molecular weight110662.53
Publications









Function






Annotated function


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP17364
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     149.21|      40|     117|     289|     330|       1
---------------------------------------------------------------------------
  289-  328 (69.61/47.66)	GLI..ESPEGTEELKWTAFTFLKIPQVLLGLKTYPQGDKGQD
  407-  448 (61.09/40.29)	GLIlrAEPTVTNILKTVDADHSKSPEGLLGVLGHMLSGKSLD
  450-  472 (18.51/ 6.90)	.LL..AAAAATGKLKSFARKFIKLNE................
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      65.83|      19|     222|     572|     591|       2
---------------------------------------------------------------------------
  572-  591 (30.80/18.69)	KWHEIClSTPAAILEVLNAW
  796-  814 (35.03/17.40)	HWHSLS.DPPGKALAKLSVW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      87.48|      25|     160|     687|     711|       4
---------------------------------------------------------------------------
  687-  711 (44.95/26.37)	PVEGQEPIPYRNLLPAKEPIHKALS
  848-  872 (42.53/24.58)	PLDDTQPSKLMRLLSSNEDEPAALS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      35.84|      11|     679|     135|     148|       9
---------------------------------------------------------------------------
  135-  148 (14.98/19.65)	CAfycDKLRELGPS
  158-  168 (20.86/12.41)	CQ...ERLHNLMSS
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP17364 with Med24 domain of Kingdom Metazoa
Unable to open file!