<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17362

Description mediator of RNA polymerase II transcription subunit 24 isoform X2
SequenceMKVVNLKQAILQAWKERWSDYQWAINIKKNFPKGATWDYLNFAEALMEQAMIGPSPNPLILSYLKYAICSQMVSYSSVLTAISKFDGFSRELCVTSLLEIMDMFCHRLNCHGKAEECIGLCRALLGVVVWLLHGCAFYCDKLRELGPSASTESILQACQERLHNLMSSTKIRALVHIARLEDQGSWNNIEQAVLKVTESLCNVSNQTLRTKLEESVSLVKSIPLMLSVQCDLPVRASFPSVHAFIMLEGTMNLTGEVQPMVEQLMMIKRMQHIPCPLFVLEIWKACFTGLIESPEGTEELKWTAFTFLKIPQVLLGLKTYPQGDKGQDFMEDVNIAFQYLLKLTPLLDKADQRCNCDCLGMLLQECNKLGLLSDLNTENLTSKREFAPRLKTAENANIQPNPGLILRAEPTVTNILKTVDADHSKSPEGLLGVLGHMLSGKSLDLLLAAAAATGKLKSFARKFIKLNEFPKHISGEGCELSDEFRWGEFFDVLLLLNADMCLRMFPSFSSLAKSASVRALLFDISFLMLCHVVQTYGSEVVLSDLSPSGETPFFETWLQTCMPEEGKTLNPDHPCFRPEPGKVESLVTLLNNSSEMKLVQVKWHEICLSTPAAILEVLNAWENGVLSVEAVQKITDNIKGKVCSMAICAVAWLVAHVRMLGRDEREKPQTMIRQLVTPHYAENTLQFYTERVVIMSSIMEHMCADVFQQTGAVLRPPVEGQEPIPYRNLLPAKEPIHKALSQQFQTVLRKAWVDSRAFHVFESLLNMGGVFWFTNNLIRELLKETRQEWAIRVVELLYSIFCLDTQQITLTLLGTILPNLLTDSAHWHSLSDPPGKALAKLSVWCALSSYSSHHKGPSSARQRKRQREDIEDYNSLFPLDDTQPSKLMRLLSSNEDEPAALSSPGDRSMNSSLSASQIHTVNMRDPLNRVLANLFLLFSSILSSRMAGPHTQFVQSFIEECVECLEQGSHGSILQFMPFTMVSELVKLPALAKPKAVLAMTDLNLPLGRRVAAKAIASL
Length1019
PositionTail
OrganismAustrofundulus limnaeus
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata> Ovalentaria> Atherinomorphae> Cyprinodontiformes> Rivulidae> Austrofundulus.
Aromaticity0.07
Grand average of hydropathy0.014
Instability index47.80
Isoelectric point6.30
Molecular weight114189.65
Publications









Function






Annotated function


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP17362
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      95.45|      26|      31|      87|     112|       1
---------------------------------------------------------------------------
   87-  112 (50.56/36.08)	GFSREL..CVTSLLEIMDMFCHRLNCHG
  119-  146 (44.89/31.12)	GLCRALlgVVVWLLHGCAFYCDKLRELG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     131.03|      40|     115|     289|     330|       2
---------------------------------------------------------------------------
  289-  328 (70.04/45.56)	GLI..ESPEGTEELKWTAFTFLKIPQVLLGLKTYPQGDKGQD
  403-  444 (60.99/38.11)	GLIlrAEPTVTNILKTVDADHSKSPEGLLGVLGHMLSGKSLD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      43.24|      12|     384|     147|     158|       6
---------------------------------------------------------------------------
  147-  158 (22.72/12.53)	PSAST...ESILQAC
  547-  561 (20.51/10.65)	PSGETpffETWLQTC
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP17362 with Med24 domain of Kingdom Metazoa
Unable to open file!