Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MTEMFPTMYGQNEAQGPPGSLSLGFGPGKLPLPLPQNQVSMAGQMPPQLGDEGPAMRKPGAMNEPFYLLRELPVGNELTGNTNLITHYNLEHAYNKFCGKKVKEKLSNFLPELPGMIDCPGTQDGSSLRSLIDKPPVCGNSFSPLTGALLTGFRLHTGPLPEQYRLMHIQPPKKKSKHKHKHHRPQDPLPQETPSDSDPKKKKKKRDDDPDRKKKKKDKKKKKNRHSPDHPGLAGSQPNSNSLR |
Length | 244 |
Position | Head |
Organism | Austrofundulus limnaeus |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata> Ovalentaria> Atherinomorphae> Cyprinodontiformes> Rivulidae> Austrofundulus. |
Aromaticity | 0.05 |
Grand average of hydropathy | -1.071 |
Instability index | 49.43 |
Isoelectric point | 9.74 |
Molecular weight | 27125.87 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP17360 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 69.38| 14| 17| 198| 212| 1 --------------------------------------------------------------------------- 178- 190 (21.76/ 7.38) ..HKHKHHRPQDPLP 198- 212 (22.15/12.29) DpKKKKKKRDDDPDR 218- 230 (25.47/ 9.96) D.KKKKKNR.HSPDH --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 54.38| 18| 24| 23| 46| 2 --------------------------------------------------------------------------- 5- 27 (31.85/16.50) FPTMYGQNE....AQGPpgslsLG.FGP 30- 54 (22.52/13.03) LPLPLPQNQvsmaGQMP...pqLGdEGP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 56.74| 18| 21| 98| 115| 3 --------------------------------------------------------------------------- 98- 115 (32.08/22.10) C.GKKVKEKLSNFL..PELPG 119- 139 (24.66/15.20) CpGTQDGSSLRSLIdkPPVCG --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DPKKKKKKRDDDPDRKKKKKDKKKKKNRHSPDHPGLA 2) YRLMHI | 198 164 | 234 169 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab