| Description | Mediator of RNA polymerase II transcription subunit 1 |
| Sequence | MMDKAIISKLHLKFAEKTWNETFQLVRKCMEKSRDKSKPCETLVRSLERLQKELRAPSMNTTKSRLETIAKQQGMGFHVTEATCYLTDNLFYVEVVLLPDGEVKEVKVAPHGKXPSLSEIKLKLLTSLQYLEKDLQQISNLQREPKDCDPQLDLINNGRVGFLIAGKEDCPLTLEFYLSPTDAPFVQAAQVTVGVSDVTHRLQMASALPQLPELDPHSCVEFAPLSEVPNEMLPACFLLRLQPPLPLMSSFVEKLRQITDVAVPEFDQQWAPLPSLLLKTSLSANPCLNTSFQQEVFIVPLPGRLMHSYVLPGAAWDVPTQRATIVDSVPFTHPAHVPALLDVLRHQCAINTLLRSCCSAQSPSPGLSCDCHFEVTPESSTSFSVTFHQPHADSLAVLLLDVSNPHHITCKLFGLERSDSSLDEYVSTVLKSCMSIPATMRALYGRLEEIMSGPVPSSRLATTEAKNDHLTPKMDTNEESAAVSQSAAVPEDDAF |
| Length | 495 |
| Position | Middle |
| Organism | Austrofundulus limnaeus |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata> Ovalentaria> Atherinomorphae> Cyprinodontiformes> Rivulidae> Austrofundulus. |
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.128 |
| Instability index | 57.53 |
| Isoelectric point | 5.49 |
| Molecular weight | 54726.37 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364059 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats | >MDP17358 No repeats found |
| MoRF Sequence | Start | Stop |
| 1) FYLRH 2) MAAFGI | 2032 1 | 2036 6 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab