<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17357
| Description |
LOW QUALITY PROTEIN: mediator of RNA polymerase II transcription subunit 29 |
| Sequence | MASQQQQPGGPMSQPGLQQTASIQQQLSQQQDFDPVHRFKMLIPQLKESLQNLMKIAALNLSHNTSIDNGIKSSDTSVQRFDKSLEEFYALCDQVELCLRLAYECLSQSIDSAKHSPNLVPTATKPDTVQTESMSXAQYLSMIKSQISCAKDIHNALLECSKKIAGKGQHQGIM |
| Length | 174 |
| Position | Tail |
| Organism | Austrofundulus limnaeus |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Ovalentaria> Atherinomorphae> Cyprinodontiformes> Rivulidae>
Austrofundulus.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.448 |
| Instability index | 63.24 |
| Isoelectric point | 6.50 |
| Molecular weight | 19136.60 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP17357
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 38.35| 12| 26| 12| 25| 2
---------------------------------------------------------------------------
12- 25 (17.39/13.53) MSQPGLQQtaSIQQ
41- 52 (20.96/10.18) MLIPQLKE..SLQN
---------------------------------------------------------------------------
|