<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17348

Description mediator of RNA polymerase II transcription subunit 27
SequenceMADVVTVGVNLDAFSHAISGIQALRSSVSRVFESLKDGMKNRETLESREKQFISEFQDNLQAVNRDLNELERLSSLVGRPSESHPLHNSGLLSLDPVQDKTPLYSQLLQAYKWSNKLQYHAGLASSLLNQQSLKRSANQMGASAKRRPKVQPSTLVLPLQYVDDVISRIGRMFPDITIELFRPNGTSAVLLVTLGKVLKAIVVMRSLFIDRTIVRGFNENVYTEDGKLDIWTKSQYHVFQKVTDHATTALLHYQLPQMPDVVVRSFMTWLRSYIKLFQSSCQRCGHFLQDGLPPTWRDFRTLEAFHDTCRM
Length311
PositionTail
OrganismAustrofundulus limnaeus
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata> Ovalentaria> Atherinomorphae> Cyprinodontiformes> Rivulidae> Austrofundulus.
Aromaticity0.08
Grand average of hydropathy-0.263
Instability index46.20
Isoelectric point9.32
Molecular weight35412.21
Publications

Function

Annotated function
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP17348
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      82.54|      25|      46|      10|      34|       1
---------------------------------------------------------------------------
   10-   34 (41.34/30.26)	NLDAFSHAISGIQALRSSVSRVFES
   59-   83 (41.20/30.13)	NLQAVNRDLNELERLSSLVGRPSES
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     107.33|      32|      32|     147|     178|       2
---------------------------------------------------------------------------
  147-  178 (55.94/38.72)	RPKVQPSTLVLPLQYVDDVISRIGRMFPDITI
  182-  213 (51.39/35.05)	RPNGTSAVLLVTLGKVLKAIVVMRSLFIDRTI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      90.41|      25|      37|     231|     259|       3
---------------------------------------------------------------------------
  231-  259 (42.41/37.99)	WTKSQYHVFQKVTDHATtallHYQLPQMP
  269-  293 (48.00/32.85)	WLRSYIKLFQSSCQRCG....HFLQDGLP
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP17348 with Med27 domain of Kingdom Metazoa

Unable to open file!