<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17333
| Description |
Mediator complex subunit 25 |
| Sequence | MVPGSEGPARAGSVVADVVFVIEGTANLGPYFEGHQGLLRCCLRRTRAWGSPSWGPHSCIHHLPSPGPHNFPRGLHCQVRCC |
| Length | 82 |
| Position | Unknown |
| Organism | Pan troglodytes (Chimpanzee) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hominidae>
Pan.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.138 |
| Instability index | 54.57 |
| Isoelectric point | 8.69 |
| Molecular weight | 8829.05 |
| Publications | PubMed=16136131
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP17333
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.42| 14| 37| 29| 42| 1
---------------------------------------------------------------------------
29- 42 (31.43/15.82) GPY.F.EGHQGLLRCC
67- 82 (23.99/10.74) GPHnFpRGLHCQVRCC
---------------------------------------------------------------------------
|