<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17316
| Description |
MED27 isoform 2 |
| Sequence | MADVINVSVNLEAFSQAISAIQALRSSVSRVFDCLKDGMRNKETLEGREKAFIAHFQDNLHSVNRDLNELERLSNLVGKPSENHPLHNSGLLSLDPVQDKTPLYSQLLQAYKWSNKKEQLSIPRIFHWKV |
| Length | 130 |
| Position | Tail |
| Organism | Pan troglodytes (Chimpanzee) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hominidae>
Pan.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.439 |
| Instability index | 34.13 |
| Isoelectric point | 7.92 |
| Molecular weight | 14825.68 |
| Publications | PubMed=16136131
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP17316
No repeats found
No repeats found
|