<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17297
Description |
Mediator complex subunit 25 |
Sequence | MVPGSEGPARAGSVVADVVFVIEGTANLGPYFEGLRKHYLLPAIEYFNGGPPAETDFGGDVTASGPPPPGPILRPQNPGANPQLRSLLLNPPPPQTGVPPPQASLHHLQPPGAPALLPPPHQGLGQPQLGPPLLHPPPAQSWPAQLPPRAPLPGQMLLSGGPRGPVPQPGLQPSVMEDDILMDLI |
Length | 185 |
Position | Unknown |
Organism | Pan troglodytes (Chimpanzee) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hominidae>
Pan.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.239 |
Instability index | 74.57 |
Isoelectric point | 5.35 |
Molecular weight | 19116.75 |
Publications | PubMed=16136131
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP17297
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 78.41| 22| 23| 92| 113| 1
---------------------------------------------------------------------------
77- 109 (38.97/ 7.01) NPGAnpqlrslllnpPPPQTGVPPPQASLHHLQ
110- 135 (39.45/ 7.19) PPGA.......pallPPPHQGLGQPQLGPPLLH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 70.08| 21| 83| 51| 73| 2
---------------------------------------------------------------------------
51- 72 (37.13/14.21) PPAET.........DFGGDVTASGpPPPGPI
137- 166 (32.95/ 6.53) PPAQSwpaqlppraPLPGQMLLSG.GPRGPV
---------------------------------------------------------------------------
|