<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17295
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MKITNGRHRDSAGAVGTMENFTALFGAQADPPPPPTALGFGPGKPPPPPPPPAGGGPGTAPPPAAATAPPGADKSGAGCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPDHPGMGSSQASSSSSLR |
| Length | 261 |
| Position | Head |
| Organism | Pan troglodytes (Chimpanzee) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hominidae>
Pan.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.987 |
| Instability index | 61.80 |
| Isoelectric point | 9.91 |
| Molecular weight | 28009.69 |
| Publications | PubMed=16136131
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
transcription factor binding GO:0008134 IBA:GO_Central
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP17295
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 80.16| 13| 14| 34| 46| 1
---------------------------------------------------------------------------
34- 46 (27.36/ 9.08) PPTALGFGPGKPP
50- 62 (26.99/ 8.86) PPPAGGGPGTAPP
69- 81 (25.81/ 8.17) PPGADKSGAGCGP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 79.91| 16| 18| 207| 222| 3
---------------------------------------------------------------------------
187- 200 (25.73/12.48) P..PKKKNKHKHKQSR
207- 222 (27.40/13.77) PETPSDSDHKKKKKKK
226- 241 (26.77/13.29) PERKRKKKEKKKKKNR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.59| 17| 115| 127| 147| 4
---------------------------------------------------------------------------
127- 147 (29.23/27.30) PDLPGMidlpGSHDNSSLRSL
244- 260 (34.36/20.60) PDHPGM....GSSQASSSSSL
---------------------------------------------------------------------------
|