<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17294
Description |
Mediator of RNA polymerase II transcription subunit 1 |
Sequence | MKAQGETEESEKLSKMSSLLERLHAKFNQNRPWSETIKLVRQVMEKRVVMSSGGHQHLVSCLETLQKALKVTSLPAMTDRLESIARQNGLGSHLSASGTECYITSDMFYVEVQLDPAGQLCDVKVAHHGENPVSCPELVQQLREKNFDEFSKHLKGLVNLYNLPGDNKLKTKMYLALQSLEQDLSKMAIMYWKATNAGPLDKILHGSVGYLTPRSGGHLMNLKYYVSPSDLLDDKTASPIILHENNVSRSLGMNASVTIEGTSAVYKLPIAPLIMGSHPVDNKWTPSFSSITSANSVDLPACFFLKFPQPIPVSRAFVQKLQNCTGIPLFETQPTYAPLYELITQFELSKDPDPIPLNHNMRFYAALPGQQHCYFLNKDAPLPDGRSLQGTLVSKITFQHPGRVPLILNLIRHQVAYNTLIGSCVKRTILKEDSPGLLQFEVCPLSESRFSVSFQHPVNDSLVCVVMDVQDSTHVSCKLYKGLSDALICTDDFIAKVVQRCMSIPVTMRAIRRKAETIQADTPALSLIAETVEDMVKKNLPPASSPGEPGLNCFTLPENQGALHFSTGWRRRGRVNQAWDTSLLSRCTHSSVSKEGKDMKSTSTYLLLLVSYVFSV |
Length | 616 |
Position | Middle |
Organism | Pan troglodytes (Chimpanzee) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hominidae>
Pan.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.191 |
Instability index | 49.28 |
Isoelectric point | 8.37 |
Molecular weight | 68439.11 |
Publications | PubMed=16136131
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364059
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP17294
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.29| 15| 98| 386| 414| 2
---------------------------------------------------------------------------
386- 401 (22.88/30.92) RSLQGTLVSkITFQHP
443- 457 (29.40/ 7.85) CPLSESRFS.VSFQHP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 84.53| 21| 25| 319| 339| 5
---------------------------------------------------------------------------
295- 313 (18.03/ 8.11) ......NSVDLPacFFLKFPQPIPV
319- 339 (39.00/26.69) Q.KL.QNCTGIP..LFETQPTYAPL
345- 367 (27.50/16.50) QfELsKDPDPIP..LNHNMRFYAAL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 153.82| 47| 48| 146| 193| 6
---------------------------------------------------------------------------
146- 193 (78.61/53.85) NFDEFSKHLKGLVNlYNLP..GDNKLKTKMYLALQSLEQDLSKMAIMYWK
196- 244 (75.21/47.37) NAGPLDKILHGSVG.YLTPrsGGHLMNLKYYVSPSDLLDDKTASPIILHE
---------------------------------------------------------------------------
|