Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MKITNARHRDSAGAEGTMENFTALFGAQADPPPPPTALGFGPGKPPPPPPPPPGGGPGTAPPPTAATAPPGADKSGAGCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPGKPS |
Length | 211 |
Position | Head |
Organism | Papio anubis (Olive baboon) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Cercopithecidae> Cercopithecinae> Papio. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.657 |
Instability index | 56.94 |
Isoelectric point | 9.51 |
Molecular weight | 22254.24 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP17252 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 57.76| 15| 15| 31| 45| 1 --------------------------------------------------------------------------- 42- 58 (31.52/ 8.77) PGKPppPPPPPPGGGPG 66- 80 (26.24/ 6.07) ATAP..PGADKSGAGCG --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 53.00| 14| 39| 84| 97| 3 --------------------------------------------------------------------------- 84- 97 (25.31/10.32) LMRELPGSTELTGS 125- 138 (27.69/11.82) FLPDLPGMIDLPGS --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) ENFTALFG 2) QPPKKKNKHKHKQSRTQ | 19 186 | 26 202 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab