<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17245
| Description |
Mediator complex subunit 25 |
| Sequence | MVPGSEGPARAGGLVADVVFVIEGTANLGPYFEGLRKHYLLPPPPGAPQGPPGTASGPPPPGPILRPQNPGANPQLRSLLLNPPPPQTGVPPPQASLHHLQPPGAPALLPPPHQGLGQPQLGPPLLHPPPAQSWPAQLPPRAPLPGQMLLSGGPRGPVPQPGLQPSVMEDDILMDLI |
| Length | 177 |
| Position | Unknown |
| Organism | Papio anubis (Olive baboon) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini>
Cercopithecidae> Cercopithecinae> Papio.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.284 |
| Instability index | 78.37 |
| Isoelectric point | 6.49 |
| Molecular weight | 18115.79 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP17245
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 66.21| 19| 40| 35| 56| 2
---------------------------------------------------------------------------
35- 56 (32.21/13.03) LRKHYLLPPPP..GAPqgPPgTAS
76- 96 (34.00/ 6.66) LRSLLLNPPPPqtGVP..PP.QAS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.99| 15| 91| 60| 74| 3
---------------------------------------------------------------------------
60- 74 (31.92/ 8.34) PPGPILRPQNPGANP
129- 143 (28.07/ 6.37) PPAQSWPAQLPPRAP
---------------------------------------------------------------------------
|