<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17227
Description |
Uncharacterized protein |
Sequence | MAASQQQASAASSAAGVSGPSSAGGPGPQQQPQPPAQLVGPAQSGLLQQQQQDFDPVQRYKMLIPQLKESLQTLMKVAAQNLIQNTNIDNGQKSSDGPIQRFDKCLEEFYALCDQLELCLPPSPTRCSLTVSPTHSTWRSSKPRFPVPRTFTPPCWTVPTRSRARHPPHLLALGAPCEVGGREWGRQWLEGGVQRE |
Length | 196 |
Position | Tail |
Organism | Papio anubis (Olive baboon) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini>
Cercopithecidae> Cercopithecinae> Papio.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.595 |
Instability index | 69.08 |
Isoelectric point | 8.85 |
Molecular weight | 21333.89 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP17227
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 74.00| 19| 19| 19| 37| 1
---------------------------------------------------------------------------
19- 37 (38.84/15.32) GPSSAGGPGPQQQPQPPAQ
40- 58 (35.16/13.28) GPAQSGLLQQQQQDFDPVQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.30| 13| 15| 126| 138| 2
---------------------------------------------------------------------------
126- 138 (24.99/13.11) RCSLTVSPTHSTW
144- 156 (28.31/15.76) RFPVPRTFTPPCW
---------------------------------------------------------------------------
|