<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17218
Description |
Uncharacterized protein |
Sequence | MADVINVSVNLEAFSQAISAIQALRSSVSRVFDCLKDGMRNKETLEGREKAFIAHFQDNLHSVNRDLNELERLSNLVGKPSENHPLHNSGLLSLDPVQDKTPLYSQLLQAYKWSNKKEQVSIPRIFHWEV |
Length | 130 |
Position | Tail |
Organism | Nomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hylobatidae>
Nomascus.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.433 |
Instability index | 34.20 |
Isoelectric point | 6.51 |
Molecular weight | 14812.60 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP17218
No repeats found
No repeats found
|