<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17199
| Description |
Uncharacterized protein |
| Sequence | MVPGSEGPARPGGLVADVVFVIEGTANLGPYFEGLRKHYLLPAIEYFNGAPQGPPGAASGPPPPGPILRPQNPGANPQLRSLLLNPPPPQTGVPPPQASLHHLQPPGAPALLPPPHQGLGQPQLGPPLLHPPPAQSWPAQLPPRAPLPXXXXXXXXPRGPVPQPGLQPSVMEDDILMDLI |
| Length | 180 |
| Position | Unknown |
| Organism | Nomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hylobatidae>
Nomascus.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.288 |
| Instability index | 81.32 |
| Isoelectric point | 6.16 |
| Molecular weight | 17814.38 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP17199
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 73.12| 23| 31| 34| 64| 2
---------------------------------------------------------------------------
47- 73 (37.56/ 8.84) FNGAPQ.GPPgAASgPPPPGpiLRPQN..P
118- 148 (35.55/ 6.23) GLGQPQlGPP.LLH.PPPAQ..LPPRAplP
---------------------------------------------------------------------------
|