<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17197
| Description |
Mediator complex subunit 16 |
| Sequence | MCDLRRPAAGGMMDLAYVCEWEKWSKSSHCPSVPLACAWSCRNLIAFTMDLRSDDQGTWLWHLTGLLCSCGGTACFLSCRLR |
| Length | 82 |
| Position | Tail |
| Organism | Nomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hylobatidae>
Nomascus.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | 0.099 |
| Instability index | 73.03 |
| Isoelectric point | 7.51 |
| Molecular weight | 9191.68 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP17197
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.37| 13| 35| 30| 42| 1
---------------------------------------------------------------------------
30- 42 (29.84/12.92) CPSVPLACAWSCR
68- 80 (28.53/12.10) CSCGGTACFLSCR
---------------------------------------------------------------------------
|