Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MAAVDIRDNLLGISWVDSSWIPILNSGSVLDYFSERSNPFYDRTCNNEVVKMQRLTLEHLNQMVGIEYILLHAQEPILFIIRKQQRQSPAQVIPLADYYIIAGVIYQAPDLGSVINSRVLTAVHGIQSAFDEAMSYCRYHPSKGYWWHFKDHEEQDKVRPKAKRKEEPSSIFQRQRVDALLLDLRQKFPPKFVQLKPGEKPVPVDQTKKEAEPVPETVKPEEKETTKNVQQTVSAKGPPEKRMRLQKAV |
Length | 249 |
Position | Head |
Organism | Gorilla gorilla gorilla (Western lowland gorilla) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hominidae> Gorilla. |
Aromaticity | 0.08 |
Grand average of hydropathy | -0.545 |
Instability index | 51.56 |
Isoelectric point | 8.90 |
Molecular weight | 28708.63 |
Publications | PubMed=22398555 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00002306 ECO:0000256 ARBA:ARBA00003882 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP17145 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 52.73| 17| 22| 189| 207| 1 --------------------------------------------------------------------------- 189- 207 (29.66/20.04) P.PKFVqlKPGEKPVP..VDQT 213- 232 (23.08/10.09) PvPETV..KPEEKETTknVQQT --------------------------------------------------------------------------- |
IDR Sequence | Start | Stop |
1) LKPGEKPVPVDQTKKEAEPVPETVKPEEKETTKNVQQTVSAKGPPEKRMRLQKAV | 195 | 249 |
MoRF Sequence | Start | Stop |
1) AKGPPEKRMRLQKAV 2) KNVQQTV | 235 227 | 249 233 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab