<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17138
| Description |
Mediator of RNA polymerase II transcription subunit 1 |
| Sequence | MKAQGETEESEKLSKMSSLLERLHAKFNQNRPWSETIKLVRQVMEKRVVMSSGGHQHLVSCLETLQKALKVTSLPAMTDRLESIARQNGLGSHLSASGTECYITSDMFYVEVQLDPAGQLCDVKVAHHGENPVSCPELVQQLREKNFDEFSKHLKGLVNLYNLPGDNKLKTKMYLALQSLEQDLSKMYYVSPSDLLDDKTASPIILHENNVSRSLGMNASVTIEGTSAVYKLPIAPLIMGSHPVDNKWTPSFSSITSANSVDLPACFFLKFPQPIPVSRAFVQKLQNCTGIPLFETQPTYAPLYELITQFELSKDPDPIPLNHNMRFYAALPGQQHCYFLNKDAPLPDGRSLQGTLVSKITFQHPGRVPLILNLIRHQVAYNTLIGSCVKRTILKEGTAFPLICLLEDGNLLLQWSHSAAIAMLTLFSSLFCRCMSIPVTMRAIRRKAETIQADTPALSLIAETVEDMVKKNLPPASSPGSKNPELGSG |
| Length | 489 |
| Position | Middle |
| Organism | Gorilla gorilla gorilla (Western lowland gorilla) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hominidae>
Gorilla.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.160 |
| Instability index | 52.38 |
| Isoelectric point | 7.95 |
| Molecular weight | 54204.05 |
| Publications | PubMed=22398555
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364059
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP17138
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 66.50| 21| 25| 283| 303| 1
---------------------------------------------------------------------------
283- 303 (39.00/18.34) Q.KL.QNCTGIPLFETQPTYAPL
309- 331 (27.50/11.33) QfELsKDPDPIPLNHNMRFYAAL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.71| 20| 30| 352| 371| 2
---------------------------------------------------------------------------
352- 371 (34.84/21.79) LQGTLVSKITFQHPGRVPLI
384- 403 (33.87/21.01) LIGSCVKRTILKEGTAFPLI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 79.08| 26| 30| 181| 206| 4
---------------------------------------------------------------------------
181- 206 (43.35/29.30) EQDLSKMYYVSPSDLLDDKTA......SPIIL
208- 239 (35.73/22.96) ENNVSRSLGMNASVTIEGTSAvyklpiAPLIM
---------------------------------------------------------------------------
|