<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17132
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNCTLSVYTC |
Length | 43 |
Position | Middle |
Organism | Gorilla gorilla gorilla (Western lowland gorilla) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hominidae>
Gorilla.
|
Aromaticity | 0.09 |
Grand average of hydropathy | 0.188 |
Instability index | 20.38 |
Isoelectric point | 4.18 |
Molecular weight | 4800.45 |
Publications | PubMed=22398555
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP17132
No repeats found
No repeats found
|