<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17122
| Description |
Mediator complex subunit 29 |
| Sequence | MLKSNGERRSRNALPAVYARKMAASQQQASAASSAAGVSGPSSAGGPGPQQQPQPPAQLVGPAQSGLLQQQQQDFDPVQRYKMLIPQLKESLQKEQ |
| Length | 96 |
| Position | Tail |
| Organism | Gorilla gorilla gorilla (Western lowland gorilla) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hominidae>
Gorilla.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.797 |
| Instability index | 92.72 |
| Isoelectric point | 10.11 |
| Molecular weight | 10183.33 |
| Publications | PubMed=22398555
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP17122
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 74.00| 19| 19| 40| 58| 1
---------------------------------------------------------------------------
40- 58 (38.84/13.48) GPSSAGGPGPQQQPQPPAQ
61- 79 (35.16/11.61) GPAQSGLLQQQQQDFDPVQ
---------------------------------------------------------------------------
|