<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17115
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MKITNARHRDSAGAEGTMENFTALFGAQADPPPPPTALGFGPGKPPPPPPPPAGGGPGTAPPPTAATAPPGADKSGAGCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPERKRKKKEKKKKKVE |
| Length | 241 |
| Position | Head |
| Organism | Gorilla gorilla gorilla (Western lowland gorilla) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hominidae>
Gorilla.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.979 |
| Instability index | 58.14 |
| Isoelectric point | 9.76 |
| Molecular weight | 26047.62 |
| Publications | PubMed=22398555
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP17115
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 71.55| 14| 17| 207| 220| 2
---------------------------------------------------------------------------
188- 201 (23.63/ 9.66) PKKKNKHKHKQSRT
207- 220 (24.32/10.11) PETPSDSDHKKKKK
226- 239 (23.59/ 9.63) PERKRKKKEKKKKK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 65.33| 16| 17| 46| 61| 3
---------------------------------------------------------------------------
46- 61 (36.55/11.44) PP....PPPPPAGGGPGTAP
62- 81 (28.78/ 7.65) PPtaatAPPGADKSGAGCGP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.00| 14| 39| 84| 97| 4
---------------------------------------------------------------------------
84- 97 (25.31/13.31) LMRELPGSTELTGS
125- 138 (27.69/15.18) FLPDLPGMIDLPGS
---------------------------------------------------------------------------
|