Description | Mediator of RNA polymerase II transcription subunit 9 |
Sequence | MASAGVAAGRQAEDALPPPAEPPLPETKPLPPSQPPPPVAAPQPQQSPAPRPQSPAGVKEEENYSFLPLVHNIIKCMDKDSPDIHQDLNALKTKFQEMRKVISTMPGIHLSPEQQQQQLHSLREQVRTKNELLQKYKSLCMFEIPKE |
Length | 147 |
Position | Middle |
Organism | Felis catus (Cat) (Felis silvestris catus) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Laurasiatheria> Carnivora> Feliformia> Felidae> Felinae> Felis. |
Aromaticity | 0.03 |
Grand average of hydropathy | -0.759 |
Instability index | 97.99 |
Isoelectric point | 6.43 |
Molecular weight | 16322.56 |
Publications | PubMed=17975172 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364145 |
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP17104 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 75.26| 18| 18| 17| 34| 1 --------------------------------------------------------------------------- 17- 34 (37.66/12.46) PPPAEPPLPETKPLPPSQ 36- 53 (37.60/12.43) PPPVAAPQPQQSPAPRPQ --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) MASAGVAAGRQAEDALP 2) QSPAGVKEEENYSFLPLV | 1 53 | 17 70 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab