| Description | Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MKTTYARHRDRAGVEETMENFSALFGAQADPPPPPTALGFGPGKPPPPPPPPPGGGPGTAPQPTSATAPPGADKSAAGCGPFYLMRELPGSTELTGSTNLITHYNLEHSYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILGGSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPDHPGVGSSQASSSSSLR |
| Length | 261 |
| Position | Head |
| Organism | Felis catus (Cat) (Felis silvestris catus) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Laurasiatheria> Carnivora> Feliformia> Felidae> Felinae> Felis. |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -1.065 |
| Instability index | 62.61 |
| Isoelectric point | 9.84 |
| Molecular weight | 28295.91 |
| Publications | PubMed=17975172 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro transcription factor binding GO:0008134 IBA:GO_Central |
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central |
| Binary Interactions |
| Repeats |
>MDP17096
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 66.67| 16| 16| 207| 222| 2
---------------------------------------------------------------------------
189- 210 (22.18/ 8.12) KKKNKHKHKQSRtqdpvpPETP
211- 229 (20.31/ 6.90) SDSDHKKKKKKK...eedPERK
230- 247 (24.18/ 9.43) RKKKEKKKKKNR....hsPDHP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 72.26| 26| 46| 106| 135| 5
---------------------------------------------------------------------------
85- 125 (34.40/28.79) MRELPGSTEL.......tgstnlithynLEHSYNKFCGkkvkEKLSNF
126- 169 (37.86/22.29) LPDLPGMIDLpgshdnsslrsliekppiLGGSFNPITG....TMLAGF
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) DRAGVEETMENFSALFG 2) DSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPD | 10 212 | 26 245 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab