<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17092
| Description |
Uncharacterized protein |
| Sequence | MADILTQLQTCLDQLATQFYATLGYLTTYHDNSPAIPPPGIPTAAPALARIPKNSSLPPAPAGAPAGAQASPPPSHTAQPGQPGGQLGGEPGAVTPGGTATGAGGDPNLPPAADSPRVFAARQRELARDLVIKEQQIEYLISVLPGIDSSEEQQERRIRELERELRGVEEERELRMRELGRLRRRLEGVLGAVDRGIYGDRA |
| Length | 202 |
| Position | Middle |
| Organism | Aspergillus steynii IBT 23096 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus>
Aspergillus subgen. Circumdati.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.491 |
| Instability index | 64.20 |
| Isoelectric point | 5.32 |
| Molecular weight | 21464.88 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP17092
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 75.15| 18| 19| 151| 168| 1
---------------------------------------------------------------------------
132- 147 (18.30/ 8.64) ..IKEQQIEY...LISVLPGI
151- 168 (31.26/19.31) EEQQERRIRE...LERELRGV
169- 189 (25.59/14.65) EEERELRMRElgrLRRRLEGV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 62.69| 19| 19| 45| 63| 2
---------------------------------------------------------------------------
45- 63 (33.97/12.76) APALAR...IPKNSSLPPAPAG
64- 85 (28.72/ 9.83) APAGAQaspPPSHTAQPGQPGG
---------------------------------------------------------------------------
|