Description | Uncharacterized protein |
Sequence | MADILTQLQTCLDQLATQFYATLGYLTTYHDNSPAIPPPGIPTAAPALARIPKNSSLPPAPAGAPAGAQASPPPSHTAQPGQPGGQLGGEPGAVTPGGTATGAGGDPNLPPAADSPRVFAARQRELARDLVIKEQQIEYLISVLPGIDSSEEQQERRIRELERELRGVEEERELRMRELGRLRRRLEGVLGAVDRGIYGDRA |
Length | 202 |
Position | Middle |
Organism | Aspergillus steynii IBT 23096 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus> Aspergillus subgen. Circumdati. |
Aromaticity | 0.03 |
Grand average of hydropathy | -0.491 |
Instability index | 64.20 |
Isoelectric point | 5.32 |
Molecular weight | 21464.88 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669 ECO:0000256 RuleBase:RU366036 |
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule |
GO - Biological Function | |
GO - Biological Process |
Binary Interactions |
Repeats | >MDP17092 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 75.15| 18| 19| 151| 168| 1 --------------------------------------------------------------------------- 132- 147 (18.30/ 8.64) ..IKEQQIEY...LISVLPGI 151- 168 (31.26/19.31) EEQQERRIRE...LERELRGV 169- 189 (25.59/14.65) EEERELRMRElgrLRRRLEGV --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 62.69| 19| 19| 45| 63| 2 --------------------------------------------------------------------------- 45- 63 (33.97/12.76) APALAR...IPKNSSLPPAPAG 64- 85 (28.72/ 9.83) APAGAQaspPPSHTAQPGQPGG --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) LARIPK 2) RLRRR | 48 181 | 53 185 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab