<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17090
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MSDRASASFRLEPPSPSSPAAGSLKENHSSFIPSEPTPQTPTSPPLMSVGAQNYASNFASSQASPSQATSQPANLSSPPSSAPMSTQASQQPTLGVTNSFPTPASSVSGHFTGATSGDDPDHPDKSGVSSASTQHAEHRRTDHDRQPGDAMMESGMRDTTHSGDPNLSRYGDGAMDVDTEPGVPSNPDEFSLDSLQKEFASAYHLCKSSHIATGPDPSLDLVSLYGLGPVAKSVARMDPVTGEKINRLRKSYEGKLKGLGLAGRNKAVKADPTSTSTLRHLTMWPEDEWQNQKVHGKEIKMADMDSALQKLHMKAMHMEPGPIPNSEQWEDVLGHEKPSKHAGSGEGSSKKAGALPNNARGPPTQPNGTPTAATASDADRSRPSRGRKRHYDENSFVGYGEGYADDDDDGAFYSNSEGMGKKKRKKEHVSKIGTPLPDRGGSYGIGMYGIGAR |
| Length | 453 |
| Position | Head |
| Organism | Aspergillus steynii IBT 23096 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus>
Aspergillus subgen. Circumdati.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.896 |
| Instability index | 44.41 |
| Isoelectric point | 6.28 |
| Molecular weight | 48034.16 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP17090
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 185.09| 43| 43| 79| 121| 1
---------------------------------------------------------------------------
34- 66 (46.93/16.08) ..SEPTPQTPTSPPLMSV......GAQNY..ASNF..ASSQASPS
79- 121 (73.50/28.97) PSSAPMSTQASQQPTLGVTNSFPTPASSV..SGHFTGATSGDDPD
123- 166 (64.65/24.67) PDKSGVSSASTQHAEHRRTDHDRQPGDAMmeSGMRDTTHSG.DPN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 71.85| 21| 43| 319| 340| 2
---------------------------------------------------------------------------
319- 340 (35.54/22.10) EPGPIPNSEQWEDVlGHEKPSK
365- 385 (36.32/18.47) QPNGTPTAATASDA.DRSRPSR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.08| 17| 25| 183| 205| 4
---------------------------------------------------------------------------
183- 205 (21.94/25.39) VPSNPDEfSLDslqkeFASAYHL
211- 227 (31.14/16.54) IATGPDP.SLD.....LVSLYGL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 66.62| 19| 54| 343| 361| 5
---------------------------------------------------------------------------
343- 361 (34.39/16.86) GSGEG..SSKKAGALPNNARG
398- 418 (32.23/15.38) GYGEGyaDDDDDGAFYSNSEG
---------------------------------------------------------------------------
|