Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MSDRASASFRLEPPSPSSPAAGSLKENHSSFIPSEPTPQTPTSPPLMSVGAQNYASNFASSQASPSQATSQPANLSSPPSSAPMSTQASQQPTLGVTNSFPTPASSVSGHFTGATSGDDPDHPDKSGVSSASTQHAEHRRTDHDRQPGDAMMESGMRDTTHSGDPNLSRYGDGAMDVDTEPGVPSNPDEFSLDSLQKEFASAYHLCKSSHIATGPDPSLDLVSLYGLGPVAKSVARMDPVTGEKINRLRKSYEGKLKGLGLAGRNKAVKADPTSTSTLRHLTMWPEDEWQNQKVHGKEIKMADMDSALQKLHMKAMHMEPGPIPNSEQWEDVLGHEKPSKHAGSGEGSSKKAGALPNNARGPPTQPNGTPTAATASDADRSRPSRGRKRHYDENSFVGYGEGYADDDDDGAFYSNSEGMGKKKRKKEHVSKIGTPLPDRGGSYGIGMYGIGAR |
Length | 453 |
Position | Head |
Organism | Aspergillus steynii IBT 23096 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus> Aspergillus subgen. Circumdati. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.896 |
Instability index | 44.41 |
Isoelectric point | 6.28 |
Molecular weight | 48034.16 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP17090 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 185.09| 43| 43| 79| 121| 1 --------------------------------------------------------------------------- 34- 66 (46.93/16.08) ..SEPTPQTPTSPPLMSV......GAQNY..ASNF..ASSQASPS 79- 121 (73.50/28.97) PSSAPMSTQASQQPTLGVTNSFPTPASSV..SGHFTGATSGDDPD 123- 166 (64.65/24.67) PDKSGVSSASTQHAEHRRTDHDRQPGDAMmeSGMRDTTHSG.DPN --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 71.85| 21| 43| 319| 340| 2 --------------------------------------------------------------------------- 319- 340 (35.54/22.10) EPGPIPNSEQWEDVlGHEKPSK 365- 385 (36.32/18.47) QPNGTPTAATASDA.DRSRPSR --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 53.08| 17| 25| 183| 205| 4 --------------------------------------------------------------------------- 183- 205 (21.94/25.39) VPSNPDEfSLDslqkeFASAYHL 211- 227 (31.14/16.54) IATGPDP.SLD.....LVSLYGL --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 66.62| 19| 54| 343| 361| 5 --------------------------------------------------------------------------- 343- 361 (34.39/16.86) GSGEG..SSKKAGALPNNARG 398- 418 (32.23/15.38) GYGEGyaDDDDDGAFYSNSEG --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) GSYGIGMYGIGAR 2) KKKRKKEHVSKIGTPL 3) RASASFRL | 441 421 4 | 453 436 11 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab