<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17088
Description |
Mediator of RNA polymerase II transcription subunit 8 |
Sequence | MSAPTQDQIKTLEQSRQRLVQLTRSLASLITSLHQGETLPPWSSLQSQASIISNNLLSVSEHLSENHDLLSSLVAYPGPSYPGRTQSNILEQLLRTKLDPRVDDWVARGRKAGDSALQDIAGLSESQLAELWHWAPVEANQQARGRNWGGNFTLEERNMGVQNVVTGLKRQLEDEDDEGRSDEEEEDEVEDEMEVVGVRRKSGAGSGLEFDIAAATHQKPTGPVVPLNEILRFMTTGAPPGQR |
Length | 243 |
Position | Head |
Organism | Aspergillus steynii IBT 23096 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus>
Aspergillus subgen. Circumdati.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.635 |
Instability index | 57.77 |
Isoelectric point | 4.80 |
Molecular weight | 26812.36 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP17088
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.71| 13| 34| 107| 119| 1
---------------------------------------------------------------------------
107- 119 (22.93/12.26) ARGRK.AGDSALQD
143- 156 (19.77/ 9.79) ARGRNwGGNFTLEE
---------------------------------------------------------------------------
|